Key Takeaways

LL-37 is often discussed as if it were already a therapeutic platform.
A better view is that it is a biologically important human antimicrobial and immunomodulatory peptide with a large preclinical literature, but the reviewed evidence does not justify broad patient-facing claims for infection treatment, wound healing, inflammation control, anti-aging, or oncology.

‍

[FDA, 2026; NCBI Gene, 2026; Reinholz et al., 2012].

Cathelicidin LL-37: an endogenous human host-defense peptide derived from the CAMP-encoded precursor hCAP18/CAP18; the mature peptide is widely listed as the 37-amino acid sequence [LL-37, 37 aa] and remains an investigational exogenous compound rather than an established therapeutic drug product in the reviewed sources.

Overview

LL-37 is scientifically credible in the narrow sense that it is a real human innate-immune peptide with extensive mechanistic literature. The core scientific and compliance problem is evidence transfer: endogenous CAMP/hCAP18 biology, disease-association papers, fragment or analogue data, and preclinical wound or infection findings are routinely easier to find than same-molecule human therapeutic proof for exogenous native LL-37. [NCBI Gene, 2026; FDA, 2026; Dürr et al., 2006]

The FDA posture is materially cautionary. On FDA's current page for bulk drug substances that may present significant safety risks in compounding, cathelicidin LL-37 appears in the "bulk drug substances nominated but withdrawn" section, with FDA citing potential immunogenicity, peptide-related impurities and API-characterization complexity, insufficient safety-related information, and nonclinical findings suggesting detrimental effects on male reproduction and possible protumorigenic effects in some tissues. [FDA, 2026]

The best-supported mechanistic backbone for LL-37 is still preclinical and translational rather than therapeutic-clinical: direct antimicrobial membrane effects, chemotaxis through FPR-family signaling, immune mediator induction, inflammatory-response regulation, and context-dependent effects on epithelial migration and angiogenic signaling. Those mechanisms are scientifically important, but they are not the same as showing that compounded or administered LL-37 is clinically effective for infection, wound healing, inflammatory disease, or cancer in humans. [NCBI Gene, 2026; De Yang et al., 2000; Koczulla et al., 2003; Gombart et al., 2005]

What it is

LL-37 is the mature cationic peptide generated from the human CAMP gene product, also referred to as hCAP18 or CAP18. NCBI identifies CAMP as a validated human protein-coding gene on chromosome 3p21.31 with 4 exons, and lists major aliases including LL37, CAP18, CAP-18, FALL39, and FALL-39. NCBI's RefSeq summary describes the encoded product as an antimicrobial peptide family member with antibacterial, antifungal, antiviral, chemotactic, immune-mediator, and inflammatory-regulatory functions. [NCBI Gene, 2026]

In the reviewed literature, LL-37 is widely described as the only human cathelicidin and as a mature peptide released by extracellular proteolysis from a larger precursor. The canonical mature sequence is commonly listed as [LL-37, 37 aa] The underlying molecule is endogenous; that fact matters biologically, but it does not make exogenous native LL-37 a validated therapeutic product. [NCBI Gene, 2026; Dürr et al., 2006]

A paper on CAMP expression, hCAP18 processing, rosacea-associated overexpression, LL-37 fragments, or sequence-modified derivatives is not automatically evidence for administered native synthetic LL-37. This distinction is especially important because FDA's current risk page discusses cathelicidin LL-37 in terms of immunogenicity, peptide impurities, characterization complexity, and inadequate safety information. [FDA, 2026; NCBI Gene, 2026]

Material	What it is	Why it cannot be collapsed into "LL-37"
CAMP gene / hCAP18 precursor	Human endogenous gene product and precursor protein.	Gene expression or precursor biology does not prove clinical benefit from administered exogenous peptide. [NCBI Gene, 2026]
Native mature LL-37	The canonical human 37-aa cathelicidin peptide.	This is the target molecule for this brief. Evidence should stay molecule-specific. [Dürr et al., 2006]
Synthetic native LL-37	Lab-made version of the native peptide sequence.	Synthetic manufacture introduces formulation, impurity, aggregation, and characterization issues that do not exist in endogenous physiology. [FDA, 2026]
Natural fragments	KR-12, FK-13, FK-16, GF-17, GI-20, and other shorter peptides derived from LL-37.	Fragment potency, selectivity, and toxicity do not automatically transfer to full-length native LL-37. [Dürr et al., 2006]
Modified analogues	Engineered derivatives such as SAAP-148 designed to improve native peptide limitations.	Analogue or derivative success does not prove native LL-37 efficacy or safety. [FDA, 2026; Dürr et al., 2006]

How it's proposed to work

The best-supported mechanistic backbone comes from two layers of evidence. First, NCBI's RefSeq summary describes CAMP/LL-37 biology in broad terms: antimicrobial defense, chemotaxis, immune-mediator induction, and inflammatory-response regulation. Second, the literature repeatedly maps LL-37 onto direct membrane-active antimicrobial effects plus pleiotropic host-cell signaling. [NCBI Gene, 2026; Dürr et al., 2006]

LL-37 is both a host-defense peptide and a context-dependent signaling peptide. It has been reported to chemoattract neutrophils, monocytes, and T cells through FPRL1/FPR2-family signaling, and mechanistic literature also links it to epithelial migration, cytokine modulation, and angiogenic signaling pathways. [De Yang et al., 2000; Koczulla et al., 2003; NCBI Gene, 2026]

Another defensible mechanistic anchor is regulation upstream of the peptide. CAMP expression is linked in the literature to vitamin D receptor signaling and to broader innate-immune activation pathways, which helps explain why LL-37 repeatedly appears in infection, inflammatory-skin, and mucosal-immunity papers. That does not mean that giving patients exogenous LL-37 reproduces the regulated biology of endogenous CAMP expression. [Gombart et al., 2005; NCBI Gene, 2026]

The mechanism map also cuts both ways. The same peptide family literature that makes LL-37 sound therapeutically promising also documents the reasons for caution: proteolytic instability, context-dependent host-cell effects, cytotoxicity at some concentrations, and the possibility that proliferative or inflammatory signaling may be beneficial in one tissue context and undesirable in another. FDA's present risk page adds a regulatory version of the same warning by flagging insufficient safety information, reproductive concerns in nonclinical findings, and possible protumorigenic effects in some tissues. [FDA, 2026; Dürr et al., 2006; von Haussen et al., 2008]

Common forms in circulation

In the current FDA material reviewed here, the relevant regulatory form is simply "cathelicidin LL-37" as a bulk drug substance discussed on a compounding safety-risk page under nominated but withdrawn substances. FDA's language does not validate route, dose, or clinical utility; it instead emphasizes immunogenicity risk, peptide-related impurities, API-characterization complexity, inadequate safety-related information, and concerning nonclinical signals. [FDA, 2026]

No robust mainstream, labeled-drug clinical product footprint for native LL-37 was identified in the reviewed sources. The circulation is a mix of research nomenclature, reagent ecosystems around CAMP/LL37, and FDA's compounding-risk discussion. [FDA, 2026; NCBI Gene, 2026]

Names and aliases

Key names and aliases include cathelicidin LL-37, LL-37, LL37, CAMP, hCAP18, CAP18, CAP-18, FALL39, and FALL-39. Related but non-equivalent names include native synthetic LL-37, fragment names such as KR-12, FK-13, FK-16, GF-17, GI-20, and engineered derivative names such as SAAP-148. [NCBI Gene, 2026; Dürr et al., 2006; Gombart et al., 2005]

Regulatory status

On FDA's current page for bulk drug substances that may present significant safety risks in compounding, cathelicidin LL-37 is listed in the section for bulk drug substances nominated but withdrawn. FDA states that compounded drugs containing cathelicidin LL-37 may pose risk for immunogenicity for certain routes of administration and may have complexities regarding peptide-related impurities and API characterization. FDA also states that it lacks sufficient safety-related information regarding cathelicidin LL-37 to know whether the drug would cause harm when administered to humans. [FDA, 2026]

FDA's page goes further for LL-37 than it does for some other peptides by specifically noting that nonclinical research findings suggest detrimental effects on male reproduction and that this drug can be protumorigenic in some tissues. [FDA, 2026]

Evidence base

Evidence tier	What qualifies	What it does not justify
Clinical trial	Same-molecule prospective interventional human study of native LL-37 with defined route, dose, population, and outcomes. In the reviewed source set, this is not the dominant evidence tier.	Saying native LL-37 is clinically proven for infection, wounds, inflammatory disease, or cancer.
Animal model	In vivo infection, inflammation, mucosal, wound, or tumor studies using native LL-37 or clearly specified constructs.	Human efficacy or route validation.
Mechanistic hypothesis	Cell, tissue, receptor, pathway, chemotaxis, biofilm, vitamin D-regulation, or expression studies.	"Treats," "heals," "prevents," or "restores" language in patients.
Anecdotal or commercial	Reagent pages, generalized peptide discourse, or consumer extrapolation from endogenous biology.	Any therapeutic claim.

Purported benefits, by evidence

Purported benefit	What the evidence supports	What it does not support	Source
Broad antimicrobial activity	CAMP/LL-37 biology is linked to antibacterial, antifungal, and antiviral activity in innate immunity, and the peptide literature supports membrane-active host-defense functions.	"Treats infection in patients" or "systemic antibiotic substitute."	[NCBI Gene, 2026; Dürr et al., 2006]
Chemotaxis / immune-cell recruitment	LL-37 has been reported to chemoattract neutrophils, monocytes, and T cells through FPR-family signaling.	"Boosts immunity" or "improves immune function" wording for consumers.	[De Yang et al., 2000; NCBI Gene, 2026]
Wound healing / re-epithelialization	Preclinical and translational literature links LL-37 with epithelial migration, wound closure biology, and angiogenic signaling.	"Heals wounds," "accelerates recovery," or validated treatment claims for chronic ulcers in humans.	[Koczulla et al., 2003; Shaykhiev et al., 2005]
Urinary-tract infection defense	Mouse and translational host-defense literature supports a role for cathelicidin in urinary-tract innate defense.	Administered LL-37 prevents or treats human UTIs.	[Chromek et al., 2006]
Rosacea relevance	Rosacea literature supports abnormal cathelicidin/serine-protease biology as a disease mechanism.	Exogenous LL-37 as a rosacea treatment; if anything, excess LL-37 biology is part of the pathology story.	[Yamasaki et al., 2007; Reinholz et al., 2012]
Psoriasis / inflammatory autoimmune relevance	LL-37 is implicated in psoriasis-related inflammatory and autoantigenic biology.	Claiming native LL-37 treats psoriasis or other autoimmune disease.	[Reinholz et al., 2012]
Cancer-related activity	The literature includes both possible anti-tumor and possible pro-growth/protumorigenic signals depending on tissue/model.	"Anti-cancer peptide" or "tumor-suppressing therapy" marketing.	[FDA, 2026; von Haussen et al., 2008]
Vitamin D–linked innate immunity	CAMP is a vitamin D-responsive innate-immune gene in the literature.	Proof that giving LL-37 externally reproduces vitamin D biology or improves immune outcomes.	[Gombart et al., 2005]
Safety by naturalness	LL-37 is endogenous. That explains why marketers find it intuitive.	Saying it is safe, well tolerated, or risk-free when compounded or administered exogenously. FDA's current page argues the opposite posture.	[FDA, 2026]

Key literature

De Yang, Chen Q, Schmidt AP, et al. LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. Journal of Experimental Medicine. 2000. A key receptor-linked chemotaxis mechanism.

Koczulla R, von Degenfeld G, Kupatt C, et al. An angiogenic role for the human peptide antibiotic LL-37/hCAP-18. Journal of Clinical Investigation. 2003. Angiogenic and repair-related signaling context.

Gombart AF, Borregaard N, Koeffler HP. Human cathelicidin antimicrobial peptide gene is a direct target of the vitamin D receptor and is strongly up-regulated in myeloid cells by 1,25-dihydroxyvitamin D3. FASEB Journal. 2005. Upstream vitamin D regulation of CAMP.

Dürr UH, Sudheendra US, Ramamoorthy A. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochimica et Biophysica Acta. 2006. Best compact synthesis of structure, mechanism, and translational challenges.

Reinholz M, Ruzicka T, Schauber J. Cathelicidin LL-37: an antimicrobial peptide with a role in inflammatory skin disease. Annals of Dermatology. 2012. Helpful disease-context synthesis for rosacea, psoriasis, and inflammatory skin biology.

References

FDA. Certain Bulk Drug Substances for Use in Compounding that May Present Significant Safety Risks. Content current as of April 22, 2026.
NCBI Gene. CAMP cathelicidin antimicrobial peptide [Homo sapiens (human)]. Gene ID: 820; updated June 4, 2026.
Sørensen OE, Follin P, Johnsen AH, et al. Human cathelicidin hCAP-18 is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3. Blood. 2001.
Chromek M, Slamová Z, Bergman P, et al. The antimicrobial peptide cathelicidin protects the urinary tract against invasive bacterial infection. Nature Medicine. 2006.
Yamasaki K, Di Nardo A, Bardan A, et al. Increased serine protease activity and cathelicidin promotes skin inflammation in rosacea. Nature Medicine. 2007.
von Haussen J, Koczulla R, Shaykhiev R, et al. The host defence peptide LL-37/hCAP-18 is a growth factor for lung cancer cells. Lung Cancer. 2008.
Camargo CA Jr, Dorer DJ, Ganmaa D, et al. Low plasma level of cathelicidin antimicrobial peptide predicts increased infectious disease mortality in patients undergoing hemodialysis. Clinical Infectious Diseases. 2009.

‍

Cathelicidin LL-37